PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00453.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 437aa    MW: 49668.3 Da    PI: 5.5963
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00453.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-142670348
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              WT+eEd +l d ++++G+++W+ Ia+++   ++  qc+ rw++yl
  Rsa1.0_00453.1_g00012.1 26 TWTAEEDVILRDQITLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 70
                             6****************************9.*************97 PP

2Myb_DNA-binding42.81.2e-1376119146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
  Rsa1.0_00453.1_g00012.1  76 RGGWSPEEDMLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 119
                              789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0881970IPR017930Myb domain
SuperFamilySSF466895.24E-2523117IPR009057Homeodomain-like
SMARTSM007173.2E-122372IPR001005SANT/Myb domain
CDDcd001678.20E-122670No hitNo description
Gene3DG3DSA:1.10.10.601.5E-192778IPR009057Homeodomain-like
PfamPF139214.3E-152787No hitNo description
PROSITE profilePS5129419.92371125IPR017930Myb domain
SMARTSM007172.0E-1475123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1879124IPR009057Homeodomain-like
CDDcd001671.93E-1079120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MEDTKKKKKK NISNEDSKKK ERHIVTWTAE EDVILRDQIT LHGTENWAII ASKFKDKSTR  60
QCRRRWYTYL NSDFKRGGWS PEEDMLLCEA QRVFGNRWTE IAKVVSGRTD NAVKNRFTTL  120
CKKRAKHEAM ANSNNSNNKR MLFLDGISTP QKSDNETPIA KRTRRSHILE HTEMSNYGKV  180
ESCLNQQARS PFSVLARNAT GIDSLEEQYQ TSNVKESDGG EGMFLKKDDP KVTALMQQAE  240
LLTSLAQKVN ADNTEQSMEN AWKVLQDFLN KGKENDLLRY GLPDIDFQLE EFRDLIGDLR  300
SSYEDNDPSW RQPDLHDSPA SSEYSSGSTI MLDQSGDRTQ PSLPDPQTER KESGEEFLST  360
DDVLKNPDEN MPISGGEENF SSPIQVTPLF RSLADGIPSP QFSESERSFL LKTLGIESSS  420
TNPSQPPPCK RVLLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-242712410107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756660.0KM975666.1 Brassica napus MYB transcription factor 124.1 (MYB124.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148726.10.0PREDICTED: myb-related protein B
TrEMBLM4DT150.0M4DT15_BRARP; Uncharacterized protein
STRINGBra019658.1-P0.0(Brassica rapa)
Orthologous Group ? help Ba